PDB entry 1dto

View 1dto on RCSB PDB site
Description: crystal structure of the complete transactivation domain of e2 protein from the human papillomavirus type 16
Class: Viral protein
Keywords: three-helix bundle, beta-sheet, Viral protein
Deposited on 2000-01-13, released 2000-02-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.236
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Regulatory protein E2
    Species: Human papillomavirus type 16 [TaxId:333760]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03120 (20-220)
      • expression tag (19)
    Domains in SCOPe 2.06: d1dtoa1, d1dtoa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dtoA (A:)
    mgsshhhhhhssglvprgshmetlcqrlnvcqdkilthyendstdlrdhidywkhmrlec
    aiyykaremgfkhinhqvvptlavsknkalqaielqltletiynsqysnekwtlqdvsle
    vyltaptgcikkhgytvevqfdgdicntmhytnwthiyiceeasvtvvegqvdyyglyyv
    hegirtyfvqfkddaekysknkvwevhaggqvilcptsvfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dtoA (A:)
    hmetlcqrlnvcqdkilthyendstdlrdhidywkhmrlecaiyykaremgfkhinhqvv
    ptlavsknkalqaielqltletiynsqysnekwtlqdvslevyltaptgcikkhgytvev
    qfdgdntmhytnwthiyiceeasvtvvegqvdyyglyyvhegirtyfvqfkddaekyskn
    kvwevhaggqvilcptsvfs