PDB entry 1dtn

View 1dtn on RCSB PDB site
Description:
Deposited on 1996-03-28, released 1996-10-14
The last revision prior to the SCOP 1.55 freeze date was dated 1996-10-14, with a file datestamp of 1996-10-15.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.171
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d1dtn_1, d1dtn_2

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dtn_ (-)
    evlitglrtravnvplaypvhtavgtvgtaplvlidlatsagvvghsylfaytpvalksl
    kqllddmaamivneplapvsleamlakrfclagytglirmaaagidmaawdalgkvhetp
    lvkllganarpvqaydshsldgvklateravtaaelgfravktkigypaldqdlavvrsi
    rqavgddfgimvdynqsldvpaaikrsqalqqegvtwieeptlqhdyeghqriqsklnvp
    vqmgenwlgpeemfkalsigacrlampdamkiggvtgwirasalaqqfgipmsshlfqei
    sahllaatptahwlqrldlagsvieptltfeggnavipdlpgvgiiwrekeigkylv