PDB entry 1dtn

View 1dtn on RCSB PDB site
Description: mandelate racemase mutant d270n co-crystallized with (s)-atrolactate
Class: racemase
Keywords: racemase, isomerase, mandelate pathway
Deposited on 1996-03-28, released 1996-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.171
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mandelate racemase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: MANDELATE RACEMASE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11444 (Start-358)
      • engineered (316)
    Domains in SCOPe 2.07: d1dtna1, d1dtna2
  • Heterogens: MG, APG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dtnA (A:)
    msevlitglrtravnvplaypvhtavgtvgtaplvlidlatsagvvghsylfaytpvalk
    slkqllddmaamivneplapvsleamlakrfclagytglirmaaagidmaawdalgkvhe
    tplvkllganarpvqaydshsldgvklateravtaaelgfravktkigypaldqdlavvr
    sirqavgddfgimvdynqsldvpaaikrsqalqqegvtwieeptlqhdyeghqriqskln
    vpvqmgenwlgpeemfkalsigacrlampdamkiggvtgwirasalaqqfgipmsshlfq
    eisahllaatptahwlqrldlagsvieptltfeggnavipdlpgvgiiwrekeigkylv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dtnA (A:)
    evlitglrtravnvplaypvhtavgtvgtaplvlidlatsagvvghsylfaytpvalksl
    kqllddmaamivneplapvsleamlakrfclagytglirmaaagidmaawdalgkvhetp
    lvkllganarpvqaydshsldgvklateravtaaelgfravktkigypaldqdlavvrsi
    rqavgddfgimvdynqsldvpaaikrsqalqqegvtwieeptlqhdyeghqriqsklnvp
    vqmgenwlgpeemfkalsigacrlampdamkiggvtgwirasalaqqfgipmsshlfqei
    sahllaatptahwlqrldlagsvieptltfeggnavipdlpgvgiiwrekeigkylv