PDB entry 1dtl

View 1dtl on RCSB PDB site
Description: crystal structure of calcium-saturated (3ca2+) cardiac troponin c complexed with the calcium sensitizer bepridil at 2.15 a resolution
Class: structural protein
Keywords: helix-turn-helix, STRUCTURAL PROTEIN
Deposited on 2000-01-12, released 2000-05-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.213
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cardiac troponin c
    Species: Gallus gallus [TaxId:9031]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09860
      • engineered (34)
      • engineered (83)
      • conflict (92)
    Domains in SCOPe 2.07: d1dtla_
  • Heterogens: CA, BEP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dtlA (A:)
    mddiykaaveqlteeqknefkaafdifvlgaedgsistkelgkvmrmlgqnptpeelqem
    idevdedgsgtvdfdeflvmmvrsmkddskgkseeelsdlfrmfdknadgyidleelkim
    lqatgetiteddieelmkdgdknndgridydeflefmkgve
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dtlA (A:)
    ykaaveqlteeqknefkaafdifvlgaedgsistkelgkvmrmlgqnptpeelqemidev
    dedgsgtvdfdeflvmmvrsmkkseeelsdlfrmfdknadgyidleelkimlqattited
    dieelmkdgdknndgridydeflefmkgv