PDB entry 1dtk

View 1dtk on RCSB PDB site
Description: the nmr solution structure of dendrotoxin k from the venom of dendroaspis polylepis polylepis
Deposited on 1993-04-02, released 1994-01-31
The last revision prior to the SCOP 1.55 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1dtk__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dtk_ (-)
    aakycklplrigpckrkipsfyykwkakqclpfdysgcggnanrfktieecrrtcvg