PDB entry 1dtk

View 1dtk on RCSB PDB site
Description: the nmr solution structure of dendrotoxin k from the venom of dendroaspis polylepis polylepis
Class: presynaptic neurotoxin
Keywords: presynaptic neurotoxin
Deposited on 1993-04-02, released 1994-01-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: dendrotoxin k
  Species: Dendroaspis polylepis polylepis [TaxId:8620]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00981 (0-56)
  Domains in SCOPe 2.08: d1dtka_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dtkA (A:)
  aakycklplrigpckrkipsfyykwkakqclpfdysgcggnanrfktieecrrtcvg