PDB entry 1dtk

View 1dtk on RCSB PDB site
Description: the nmr solution structure of dendrotoxin k from the venom of dendroaspis polylepis polylepis
Class: presynaptic neurotoxin
Keywords: presynaptic neurotoxin
Deposited on 1993-04-02, released 1994-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dendrotoxin k
    Species: Dendroaspis polylepis polylepis [TaxId:8620]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dtka_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dtkA (A:)
    aakycklplrigpckrkipsfyykwkakqclpfdysgcggnanrfktieecrrtcvg