PDB entry 1dtj

View 1dtj on RCSB PDB site
Description: crystal structure of nova-2 kh3 k-homology rna-binding domain
Deposited on 2000-01-12, released 2000-02-18
The last revision prior to the SCOP 1.71 freeze date was dated 2000-02-18, with a file datestamp of 2000-02-18.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.225
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1dtja_
  • Chain 'B':
    Domains in SCOP 1.71: d1dtjb_
  • Chain 'C':
    Domains in SCOP 1.71: d1dtjc_
  • Chain 'D':
    Domains in SCOP 1.71: d1dtjd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dtjA (A:)
    mkelvemavpenlvgailgkggktlveyqeltgariqiskkgeflpgtrnrrvtitgspa
    atqaaqylisqrvtye
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dtjA (A:)
    mkelvemavpenlvgailgkggktlveyqeltgariqiskkgeflpgtrnrrvtitgspa
    atqaaqylisqrvt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dtjB (B:)
    mkelvemavpenlvgailgkggktlveyqeltgariqiskkgeflpgtrnrrvtitgspa
    atqaaqylisqrvtye
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dtjB (B:)
    mkelvemavpenlvgaitlveyqeltgariqistrnrrvtitgspaatqaaqylisqrvt
    ye
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1dtjC (C:)
    mkelvemavpenlvgailgkggktlveyqeltgariqiskkgeflpgtrnrrvtitgspa
    atqaaqylisqrvtye
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dtjC (C:)
    mkelvemavpenlvgailgkggktlveyqeltgariqistrnrrvtitgspaatqaaqyl
    isqrvt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1dtjD (D:)
    mkelvemavpenlvgailgkggktlveyqeltgariqiskkgeflpgtrnrrvtitgspa
    atqaaqylisqrvtye
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dtjD (D:)
    mkelvemavpenlvgailgkggktlveyqeltgariqisrnrrvtitgspaatqaaqyli
    sqrv