PDB entry 1dtj

View 1dtj on RCSB PDB site
Description: crystal structure of nova-2 kh3 k-homology RNA-binding domain
Class: immune system
Keywords: KH domain, alpha-beta fold RNA-binding motif, IMMUNE SYSTEM
Deposited on 2000-01-12, released 2000-02-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.225
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA-binding neurooncological ventral antigen 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UNW9 (1-End)
      • expression artifact (0)
      • engineered (6)
    Domains in SCOPe 2.07: d1dtja_
  • Chain 'B':
    Compound: RNA-binding neurooncological ventral antigen 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UNW9 (1-75)
      • expression artifact (0)
      • engineered (6)
    Domains in SCOPe 2.07: d1dtjb_
  • Chain 'C':
    Compound: RNA-binding neurooncological ventral antigen 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UNW9 (1-End)
      • expression artifact (0)
      • engineered (6)
    Domains in SCOPe 2.07: d1dtjc_
  • Chain 'D':
    Compound: RNA-binding neurooncological ventral antigen 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UNW9 (1-End)
      • expression artifact (0)
      • engineered (6)
    Domains in SCOPe 2.07: d1dtjd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dtjA (A:)
    mkelvemavpenlvgailgkggktlveyqeltgariqiskkgeflpgtrnrrvtitgspa
    atqaaqylisqrvtye
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dtjA (A:)
    mkelvemavpenlvgailgkggktlveyqeltgariqiskkgeflpgtrnrrvtitgspa
    atqaaqylisqrvt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dtjB (B:)
    mkelvemavpenlvgailgkggktlveyqeltgariqiskkgeflpgtrnrrvtitgspa
    atqaaqylisqrvtye
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dtjB (B:)
    mkelvemavpenlvgaitlveyqeltgariqistrnrrvtitgspaatqaaqylisqrvt
    ye
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1dtjC (C:)
    mkelvemavpenlvgailgkggktlveyqeltgariqiskkgeflpgtrnrrvtitgspa
    atqaaqylisqrvtye
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dtjC (C:)
    mkelvemavpenlvgailgkggktlveyqeltgariqistrnrrvtitgspaatqaaqyl
    isqrvt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1dtjD (D:)
    mkelvemavpenlvgailgkggktlveyqeltgariqiskkgeflpgtrnrrvtitgspa
    atqaaqylisqrvtye
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dtjD (D:)
    mkelvemavpenlvgailgkggktlveyqeltgariqisrnrrvtitgspaatqaaqyli
    sqrv