PDB entry 1dti

View 1dti on RCSB PDB site
Description: recombinant sperm whale myoglobin h97d, d122n mutant (met)
Deposited on 2000-01-12, released 2000-01-30
The last revision prior to the SCOP 1.55 freeze date was dated 2000-01-30, with a file datestamp of 2000-01-30.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.182
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1dtia_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dtiA (A:)
    mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
    dlkkhgvtvltalgailkkkghheaelkplaqshatkdkipikylefiseaiihvlhsrh
    pgnfgadaqgamnkalelfrkdiaakykelgyqg