PDB entry 1dth

View 1dth on RCSB PDB site
Description: metalloprotease
Class: hydrolase
Keywords: hydrolase, metalloprotease, zinc, venom
Deposited on 1996-02-12, released 1997-02-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.168
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: atrolysin c
    Species: Crotalus atrox [TaxId:8730]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dtha_
  • Chain 'B':
    Compound: atrolysin c
    Species: Crotalus atrox [TaxId:8730]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dthb_
  • Heterogens: ZN, CA, BAT

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dthA (A:)
    qqnlpqryielvvvadhrvfmkynsdlntirtrvheivnfingfyrslnihvsltdleiw
    snedqiniqsassdtlnafaewretdllnrkshdnaqlltaieldeetlglaplgtmcdp
    klsigivqdhspinllmgvtmahelghnlgmehdgkdclrgaslcimrpgltkgrsyefs
    ddsmhyyerflkqykpqcilnkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dthA (A:)
    qnlpqryielvvvadhrvfmkynsdlntirtrvheivnfingfyrslnihvsltdleiws
    nedqiniqsassdtlnafaewretdllnrkshdnaqlltaieldeetlglaplgtmcdpk
    lsigivqdhspinllmgvtmahelghnlgmehdgkdclrgaslcimrpgltkgrsyefsd
    dsmhyyerflkqykpqcilnkp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dthB (B:)
    qqnlpqryielvvvadhrvfmkynsdlntirtrvheivnfingfyrslnihvsltdleiw
    snedqiniqsassdtlnafaewretdllnrkshdnaqlltaieldeetlglaplgtmcdp
    klsigivqdhspinllmgvtmahelghnlgmehdgkdclrgaslcimrpgltkgrsyefs
    ddsmhyyerflkqykpqcilnkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dthB (B:)
    qnlpqryielvvvadhrvfmkynsdlntirtrvheivnfingfyrslnihvsltdleiws
    nedqiniqsassdtlnafaewretdllnrkshdnaqlltaieldeetlglaplgtmcdpk
    lsigivqdhspinllmgvtmahelghnlgmehdgkdclrgaslcimrpgltkgrsyefsd
    dsmhyyerflkqykpqcilnkp