PDB entry 1dtg

View 1dtg on RCSB PDB site
Description: human transferrin n-lobe mutant h249e
Class: metal transport
Keywords: iron transport, glycoprotein, metal-binding, repeat, signal, polymorphism, 3d- structure, metal transport
Deposited on 2000-01-12, released 2000-01-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.198
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transferrin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02787 (Start-333)
      • engineered (248)
      • conflict (221)
    Domains in SCOPe 2.06: d1dtga_
  • Heterogens: FE, CO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dtgA (A:)
    vpdktvrwcavseheatkcqsfrdhmksvipsdgpsvacvkkasyldciraiaaneadav
    tldaglvydaylapnnlkpvvaefygskedpqtfyyavavvkkdsgfqmnqlrgkkscht
    glgrsagwnipigllycdlpeprkplekavanffsgscapcadgtdfpqlcqlcpgcgcs
    tlnqyfgysgafkclkdgagdvafvkhstifenlankadrdnyellcldntrkpvdeykd
    chlaqvpsetvvarsmggkedliwellnqaqehfgkdkskefqlfssphgkdllfkdsah
    gflkvpprmdakmylgyeyvtairnlregtcpea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dtgA (A:)
    ktvrwcavseheatkcqsfrdhmksvipsdgpsvacvkkasyldciraiaaneadavtld
    aglvydaylapnnlkpvvaefygskedpqtfyyavavvkkdsgfqmnqlrgkkschtglg
    rsagwnipigllycdlpeprkplekavanffsgscapcadgtdfpqlcqlcpgcgcstln
    qyfgysgafkclkdgagdvafvkhstifenlankadrdnyellcldntrkpvdeykdchl
    aqvpsetvvarsmggkedliwellnqaqehfgkdkskefqlfssphgkdllfkdsahgfl
    kvpprmdakmylgyeyvtairnlregtcpea