PDB entry 1dtd

View 1dtd on RCSB PDB site
Description: crystal structure of the complex between the leech carboxypeptidase inhibitor and the human carboxypeptidase a2 (lci-cpa2)
Class: hydrolase/hydrolase inhibitor
Keywords: Carboxypeptidase A2, Leech Carboxypeptidase Inhibitor, HYDROLASE/HYDROLASE INHIBITOR COMPLEX
Deposited on 2000-01-12, released 2000-07-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.187
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carboxypeptidase a2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P48052 (0-302)
      • insertion (127)
      • conflict (224-225)
    Domains in SCOPe 2.07: d1dtda_
  • Chain 'B':
    Compound: Metallocarboxypeptidase inhibitor
    Species: Hirudo medicinalis [TaxId:6421]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dtdb_
  • Heterogens: ZN, GLU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dtdA (A:)
    fnfgayhtleeisqemdnlvaehpglvskvnigssfenrpmnvlkfstggdkpaiwldag
    iharewvtqatalwtankivsdygkdpsitsildaldifllpvtnpdgyvfsqtknrmwr
    ktrskvsagslcvgvdpnrnwdagfggpgassnpcsdsyhgpsansevevksivdfiksh
    gkvkafiilhsysqllmfpygykctklddfdelsevaqkaaqslsrlhgtkykvgpicsv
    iyqasggsidwsydygikysfafelrdtgrygfllparqilptaeetwlglkaimehvrd
    hpy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dtdB (B:)
    desflcyqpdqvccficrgaaplpsegecnphptapwcregavewvpystgqcrttcipy
    v