PDB entry 1dt9

View 1dt9 on RCSB PDB site
Description: the crystal structure of human eukaryotic release factor erf1-mechanism of stop codon recognition and peptidyl-tRNA hydrolysis
Class: translation
Keywords: erf1, trna mimicry, protein sythesis, stop codon recognition, peptidyl-trna hydrolysis, TRANSLATION
Deposited on 2000-01-12, released 2000-02-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.246
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (eukaryotic peptide chain release factor subunit 1)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dt9a1, d1dt9a2, d1dt9a3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dt9A (A:)
    maddpsaadrnveiwkikkliksleaargngtsmisliippkdqisrvakmladefgtas
    niksrvnrlsvlgaitsvqqrlklynkvppnglvvycgtivteegkekkvnidfepfkpi
    ntslylcdnkfhtealtallsddskfgfividgsgalfgtlqgntrevlhkftvdlpkkh
    grggqsalrfarlrmekrhnyvrkvaetavqlfisgdkvnvaglvlagsadfktelsqsd
    mfdqrlqskvlklvdisyggengfnqaielstevlsnvkfiqekkligryfdeisqdtgk
    ycfgvedtlkalemgaveilivyenldimryvlhcqgteeekilyltpeqekdkshftdk
    etgqeheliesmpllewfannykkfgatleivtdksqegsqfvkgfggiggilryrvdfq
    gmeyqggddeffdlddy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dt9A (A:)
    psaadrnveiwkikkliksleaargngtsmisliippkdqisrvakmladefgtasniks
    rvnrlsvlgaitsvqqrlklynkvppnglvvycgtivteegkekkvnidfepfkpintsl
    ylcdnkfhtealtallsddskfgfividgsgalfgtlqgntrevlhkftvdlpkkhgrgg
    qsalrfarlrmekrhnyvrkvaetavqlfisgdkvnvaglvlagsadfktelsqsdmfdq
    rlqskvlklvdisyggengfnqaielstevlsnvkfiqekkligryfdeisqdtgkycfg
    vedtlkalemgaveilivyenldimryvlilyltpeqekdkshftesmpllewfannykk
    fgatleivtdksqegsqfvkgfggiggilryrvdfqgm