PDB entry 1dt7
View 1dt7 on RCSB PDB site
Description: solution structure of the c-terminal negative regulatory domain of p53 in a complex with ca2+-bound s100b(bb)
Class: signaling protein
Keywords: S100B, p53, C-terminal domain of p53, Calcium-binding, NMR, EF-hand, S100 protein, four helix bundle, helix loop helix, SIGNALING PROTEIN
Deposited on
2000-01-11, released
2000-07-26
The last revision prior to the SCOPe 2.05 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: s100 calcium-binding protein
Species: Rattus norvegicus [TaxId:10116]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d1dt7a_ - Chain 'B':
Compound: s100 calcium-binding protein
Species: Rattus norvegicus [TaxId:10116]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d1dt7b_ - Chain 'X':
Compound: Cellular tumor antigen p53
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d1dt7x_ - Chain 'Y':
Compound: Cellular tumor antigen p53
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d1dt7y_ - Heterogens: CA
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1dt7A (A:)
mselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
ldedgdgecdfqefmafvsmvttacheffehe
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1dt7B (B:)
mselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
ldedgdgecdfqefmafvsmvttacheffehe
- Chain 'X':
Sequence; same for both SEQRES and ATOM records: (download)
>1dt7X (X:)
shlkskkgqstsrhkklmfkte
- Chain 'Y':
Sequence; same for both SEQRES and ATOM records: (download)
>1dt7Y (Y:)
shlkskkgqstsrhkklmfkte