PDB entry 1dt7
View 1dt7 on RCSB PDB site
Description: solution structure of the c-terminal negative regulatory domain of p53 in a complex with ca2+-bound s100b(bb)
Deposited on
2000-01-11, released
2000-07-26
The last revision prior to the SCOP 1.55 freeze date was dated
2000-07-26, with a file datestamp of
2000-07-26.
Experiment type: NMR40
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.11
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Domains in SCOP 1.55: d1dt7a_ - Chain 'B':
Domains in SCOP 1.55: d1dt7b_ - Chain 'X':
Domains in SCOP 1.55: d1dt7x_ - Chain 'Y':
Domains in SCOP 1.55: d1dt7y_
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1dt7A (A:)
mselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
ldedgdgecdfqefmafvsmvttacheffehe
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1dt7B (B:)
mselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
ldedgdgecdfqefmafvsmvttacheffehe
- Chain 'X':
No sequence available.
- Chain 'Y':
No sequence available.