PDB entry 1dt7

View 1dt7 on RCSB PDB site
Description: solution structure of the c-terminal negative regulatory domain of p53 in a complex with ca2+-bound s100b(bb)
Class: signaling protein
Keywords: S100B, p53, C-terminal domain of p53, Calcium-binding, EF-hand, S100 protein, four helix bundle, helix loop helix, SIGNALING PROTEIN
Deposited on 2000-01-11, released 2000-07-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-04-27, with a file datestamp of 2016-04-22.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: s100 calcium-binding protein
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1dt7a_
  • Chain 'B':
    Compound: s100 calcium-binding protein
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1dt7b_
  • Chain 'X':
    Compound: Cellular tumor antigen p53
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1dt7x_
  • Chain 'Y':
    Compound: Cellular tumor antigen p53
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1dt7y_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dt7A (A:)
    mselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
    ldedgdgecdfqefmafvsmvttacheffehe
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dt7B (B:)
    mselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
    ldedgdgecdfqefmafvsmvttacheffehe
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dt7X (X:)
    shlkskkgqstsrhkklmfkte
    

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dt7Y (Y:)
    shlkskkgqstsrhkklmfkte