PDB entry 1dt7

View 1dt7 on RCSB PDB site
Description: solution structure of the c-terminal negative regulatory domain of p53 in a complex with ca2+-bound s100b(bb)
Class: signaling protein
Keywords: S100B, p53, C-terminal domain of p53, Calcium-binding, EF-hand, S100 protein, four helix bundle, helix loop helix, SIGNALING PROTEIN
Deposited on 2000-01-11, released 2000-07-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-04-27, with a file datestamp of 2016-04-22.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: s100 calcium-binding protein
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04631 (0-91)
  Domains in SCOPe 2.08: d1dt7a_
• Chain 'B':
  Compound: s100 calcium-binding protein
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04631 (0-91)
  Domains in SCOPe 2.08: d1dt7b_
• Chain 'X':
  Compound: Cellular tumor antigen p53
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04637 (0-21)
  Domains in SCOPe 2.08: d1dt7x_
• Chain 'Y':
  Compound: Cellular tumor antigen p53
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04637 (0-21)
  Domains in SCOPe 2.08: d1dt7y_
• Heterogens: CA

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dt7A (A:)
  mselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
  ldedgdgecdfqefmafvsmvttacheffehe
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dt7B (B:)
  mselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
  ldedgdgecdfqefmafvsmvttacheffehe
  

  
  
• Chain 'X':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dt7X (X:)
  shlkskkgqstsrhkklmfkte
  

  
  
• Chain 'Y':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dt7Y (Y:)
  shlkskkgqstsrhkklmfkte