PDB entry 1dt6

View 1dt6 on RCSB PDB site
Description: structure of mammalian cytochrome p450 2c5
Class: oxidoreductase
Keywords: membrane protein, progesterone 21-hydroxylase, benzo(a)pyrene hydroxylase, estradiol 2-hydroxylase, P450, CYP2C5, OXIDOREDUCTASE
Deposited on 2000-01-11, released 2000-09-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.238
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450 2c5
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00179 (Start-468)
      • engineered (78)
      • engineered (183)
      • engineered (187-188)
      • engineered (190-191)
      • engineered (233)
      • c-terminal his tag (469-470)
    Domains in SCOPe 2.07: d1dt6a1, d1dt6a2
  • Heterogens: SM, SO4, HEM

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dt6A (A:)
    makktsskgklppgptpfpiignilqidakdisksltkfsecygpvftvylgmkptvvlh
    gyeavkealvdlgeefagrgsvpilekvskglgiafsnaktwkemrrfslmtlrnfgmgk
    rsiedriqeearclveelrktnaspcdptfilgcapcnvicsvifhnrfdykdeeflklm
    eslhenvellgtpwlqvynnfpalldyfpgihktllknadyiknfimekvkehqklldvn
    nprdfidcflikmeqennleftleslviavsdlfgagtettsttlryslllllkhpevaa
    rvqeeiervigrhrspcmqdrsrmpytdaviheiqrfidllptnlphavtrdvrfrnyfi
    pkgtdiitsltsvlhdekafpnpkvfdpghfldesgnfkksdyfmpfsagkrmcvgegla
    rmelflfltsilqnfklqslvepkdlditavvngfvsvppsyqlcfipihhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dt6A (A:)
    ppgptpfpiignilqidakdisksltkfsecygpvftvylgmkptvvlhgyeavkealvd
    lgeefagrgsvpilekvskglgiafsnaktwkemrrfslmtlrnfgmgkrsiedriqeea
    rclveelrktnaspcdptfilgcapcnvicsvifhnrfdykdeeflklmeslhenvellg
    tpldyfpgihktllknadyiknfimekvkehqklldvnnprdfidcflikmeqennleft
    leslviavsdlfgagtettsttlryslllllkhpevaarvqeeiervigrhrspcmqdrs
    rmpytdaviheiqrfidllptnlphavtrdvrfrnyfipkgtdiitsltsvlhdekafpn
    pkvfdpghfldesgnfkksdyfmpfsagkrmcvgeglarmelflfltsilqnfklqslve
    pkdlditavvngfvsvppsyqlcfipihh