PDB entry 1dt4

View 1dt4 on RCSB PDB site
Description: crystal structure of nova-1 kh3 k-homology rna-binding domain
Deposited on 2000-01-11, released 2000-02-11
The last revision prior to the SCOP 1.69 freeze date was dated 2000-05-10, with a file datestamp of 2000-05-10.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.222
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1dt4a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dt4A (A:)
    mkdvveiavpenlvgailgkggktlveyqeltgcriqiskkgeflpgtrnrkvtitgtpa
    atqaaqylitqri