PDB entry 1dt2

View 1dt2 on RCSB PDB site
Description: crystal structure of exfoliative toxin b
Class: toxin, hydrolase
Keywords: toxin, epidermolysis, superantigen, serine protease, hydrolase
Deposited on 2000-01-11, released 2003-01-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.224
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: exfoliative toxin b
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1dt2a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dt2A (A:)
    eysaeeirklkqkfevpptdkelythitdnarspynsvgtvfvkgstlatgvligkntiv
    tnyhvareaaknpsniiftpaqnrdaeknefptpygkfeaeeikespygqgldlaiiklk
    pnekgesagdliqpanipdhidiqkgdkysllgypynysayslyqsqiemfndsqyfgyt
    evgnsgsgifnlkgeligihsgkggqhnlpigvffnrkisslysvdntfgdtlgndlkkr
    akldk