PDB entry 1dsz

View 1dsz on RCSB PDB site
Description: structure of the rxr/rar dna-binding domain heterodimer in complex with the retinoic acid response element dr1
Deposited on 2000-01-10, released 2000-07-10
The last revision prior to the SCOP 1.55 freeze date was dated 2000-07-10, with a file datestamp of 2000-07-10.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.198
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1dsza_
  • Chain 'B':
    Domains in SCOP 1.55: d1dszb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dszA (A:)
    pcfvcqdkssgyhygvsacegckgffrrsiqknmvytchrdknciinkvtrnrcqycrlq
    kcfevgmskesvrnd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dszB (B:)
    gsftkhicaicgdrssgkhygvyscegckgffkrtvrkdltytcrdnkdclidkrqrnrc
    qycryqkclamgmkreavqeerqr