PDB entry 1dsy

View 1dsy on RCSB PDB site
Description: c2 domain from protein kinase c (alpha) complexed with ca2+ and phosphatidylserine
Deposited on 2000-01-10, released 2000-01-26
The last revision prior to the SCOP 1.55 freeze date was dated 2000-01-26, with a file datestamp of 2000-01-25.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.195
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1dsya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dsyA (A:)
    tekrgriylkaevtdeklhvtvrdaknlipmdpnglsdpyvklklipdpkneskqktkti
    rstlnpqwnesftfklkpsdkdrrlsveiwdwdrttrndfmgslsfgvselmkmpasgwy
    kllnqeegeyynvpipe