PDB entry 1dsy

View 1dsy on RCSB PDB site
Description: c2 domain from protein kinase c (alpha) complexed with ca2+ and phosphatidylserine
Class: transferase
Keywords: calcium++, phospholipid binding protein, calcium-binding protein, phosphatidylserine, protein kinase c, transferase
Deposited on 2000-01-10, released 2000-01-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.195
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein kinase c, alpha type
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dsya_
  • Heterogens: CA, PO4, PSF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dsyA (A:)
    htekrgriylkaevtdeklhvtvrdaknlipmdpnglsdpyvklklipdpkneskqktkt
    irstlnpqwnesftfklkpsdkdrrlsveiwdwdrttrndfmgslsfgvselmkmpasgw
    ykllnqeegeyynvpipeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dsyA (A:)
    tekrgriylkaevtdeklhvtvrdaknlipmdpnglsdpyvklklipdpkneskqktkti
    rstlnpqwnesftfklkpsdkdrrlsveiwdwdrttrndfmgslsfgvselmkmpasgwy
    kllnqeegeyynvpipe