PDB entry 1dsx

View 1dsx on RCSB PDB site
Description: kv1.2 t1 domain, residues 33-119, t46v mutant
Class: signaling protein
Keywords: voltage-gated potassium channel, assembly domain, tetramer, signaling protein
Deposited on 2000-01-10, released 2000-09-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.237
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (kv1.2 voltage-gated potassium channel)
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63142 (0-86)
      • engineered (13)
    Domains in SCOPe 2.08: d1dsxa_
  • Chain 'B':
    Compound: protein (kv1.2 voltage-gated potassium channel)
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63142 (0-86)
      • engineered (13)
    Domains in SCOPe 2.08: d1dsxb_
  • Chain 'C':
    Compound: protein (kv1.2 voltage-gated potassium channel)
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63142 (0-86)
      • engineered (13)
    Domains in SCOPe 2.08: d1dsxc_
  • Chain 'D':
    Compound: protein (kv1.2 voltage-gated potassium channel)
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63142 (0-86)
      • engineered (13)
    Domains in SCOPe 2.08: d1dsxd_
  • Chain 'E':
    Compound: protein (kv1.2 voltage-gated potassium channel)
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63142 (0-86)
      • engineered (13)
    Domains in SCOPe 2.08: d1dsxe_
  • Chain 'F':
    Compound: protein (kv1.2 voltage-gated potassium channel)
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63142 (0-86)
      • engineered (13)
    Domains in SCOPe 2.08: d1dsxf_
  • Chain 'G':
    Compound: protein (kv1.2 voltage-gated potassium channel)
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63142 (0-86)
      • engineered (13)
    Domains in SCOPe 2.08: d1dsxg_
  • Chain 'H':
    Compound: protein (kv1.2 voltage-gated potassium channel)
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63142 (0-86)
      • engineered (13)
    Domains in SCOPe 2.08: d1dsxh_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dsxA (A:)
    ervvinisglrfevqlktlaqfpetllgdpkkrmryfdplrneyffdrnrpsfdailyyy
    qsggrlrrpvnvpldifseeirfyelg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dsxB (B:)
    ervvinisglrfevqlktlaqfpetllgdpkkrmryfdplrneyffdrnrpsfdailyyy
    qsggrlrrpvnvpldifseeirfyelg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dsxC (C:)
    ervvinisglrfevqlktlaqfpetllgdpkkrmryfdplrneyffdrnrpsfdailyyy
    qsggrlrrpvnvpldifseeirfyelg
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dsxD (D:)
    ervvinisglrfevqlktlaqfpetllgdpkkrmryfdplrneyffdrnrpsfdailyyy
    qsggrlrrpvnvpldifseeirfyelg
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dsxE (E:)
    ervvinisglrfevqlktlaqfpetllgdpkkrmryfdplrneyffdrnrpsfdailyyy
    qsggrlrrpvnvpldifseeirfyelg
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dsxF (F:)
    ervvinisglrfevqlktlaqfpetllgdpkkrmryfdplrneyffdrnrpsfdailyyy
    qsggrlrrpvnvpldifseeirfyelg
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dsxG (G:)
    ervvinisglrfevqlktlaqfpetllgdpkkrmryfdplrneyffdrnrpsfdailyyy
    qsggrlrrpvnvpldifseeirfyelg
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dsxH (H:)
    ervvinisglrfevqlktlaqfpetllgdpkkrmryfdplrneyffdrnrpsfdailyyy
    qsggrlrrpvnvpldifseeirfyelg