PDB entry 1dsw

View 1dsw on RCSB PDB site
Description: the solution structure of a monomeric, reduced form of human copper, zinc superoxide dismutase bearing the same charge as the native protein
Deposited on 2000-01-10, released 2000-03-22
The last revision prior to the SCOP 1.69 freeze date was dated 2000-03-22, with a file datestamp of 2000-03-22.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: -1.98 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.69: d1dswa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dswA (A:)
  atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvheeedntagctsa
  gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
  ekaddlgkggneestktgnagsrlacgkigkaq