PDB entry 1dsw

View 1dsw on RCSB PDB site
Description: the solution structure of a monomeric, reduced form of human copper, zinc superoxide dismutase bearing the same charge as the native protein
Class: oxidoreductase
Keywords: reduced copper-zinc-protein, beta barrel, single alpha helix, oxidoreductase
Deposited on 2000-01-10, released 2000-03-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -1.97 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: superoxide dismutase (cu-zn)
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00441 (0-152)
  Domains in SCOPe 2.08: d1dswa_
• Heterogens: CU, ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dswA (A:)
  atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvheeedntagctsa
  gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
  ekaddlgkggneestktgnagsrlacgkigkaq