PDB entry 1dsv

View 1dsv on RCSB PDB site
Description: structure of the mmtv nucleocapsid protein (c-terminal zinc finger)
Class: Viral protein
Keywords: CCHC type zinc finger, VIRUS/VIRAL PROTEIN
Deposited on 2000-01-08, released 2000-01-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: nucleic acid binding protein p14
  Species: Mouse mammary tumor virus [TaxId:11757]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P11284 (0-30)
  Domains in SCOPe 2.08: d1dsva_
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dsvA (A:)
  ppglcprckkgyhwkseckskfdkdgnplpp