PDB entry 1dss

View 1dss on RCSB PDB site
Description: structure of active-site carboxymethylated d-glyceraldehyde-3-phosphate dehydrogenase from palinurus versicolor
Class: active-site carboxymethylation
Keywords: active-site carboxymethylation, d-glyceraldehyde-3-phosphate-dehydrogenase, 'the-half-of-sites' reaction, molecular symmetry
Deposited on 1997-06-04, released 1998-12-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: 0.172
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'G':
    Compound: d-glyceraldehyde-3-phosphate-dehydrogenase
    Species: Palinurus versicolor [TaxId:82835]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56649 (0-332)
      • conflict (147)
    Domains in SCOPe 2.07: d1dssg1, d1dssg2
  • Chain 'R':
    Compound: d-glyceraldehyde-3-phosphate-dehydrogenase
    Species: Palinurus versicolor [TaxId:82835]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56649 (0-332)
      • conflict (147)
    Domains in SCOPe 2.07: d1dssr1, d1dssr2
  • Heterogens: SO4, NAD, HOH

PDB Chain Sequences:

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dssG (G:)
    skigingfgrigrlvlraalemgaqvvavndpfialeymvymfkydsthgmfkgevkaed
    galvvdgkkitvfnemkpenipwskagaeyivestgvfttiekasahfkggakkviisap
    sadapmfvcgvnlekyskdmkvvsnascttnclapvakvlhenfeiveglmttvhavtat
    qktvdgpsakdwrggrgaaqniipsstgaakavgkvipeldgkltgmafrvptpnvsvvd
    ltvrlgkecsyddikaamkaasegplqgvlgyteddvvscdftgdnrssifdakagiqls
    ktfvkvvswydnefgysqrvidlikhmqkvdsa
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dssR (R:)
    skigingfgrigrlvlraalemgaqvvavndpfialeymvymfkydsthgmfkgevkaed
    galvvdgkkitvfnemkpenipwskagaeyivestgvfttiekasahfkggakkviisap
    sadapmfvcgvnlekyskdmkvvsnascttnclapvakvlhenfeiveglmttvhavtat
    qktvdgpsakdwrggrgaaqniipsstgaakavgkvipeldgkltgmafrvptpnvsvvd
    ltvrlgkecsyddikaamkaasegplqgvlgyteddvvscdftgdnrssifdakagiqls
    ktfvkvvswydnefgysqrvidlikhmqkvdsa