PDB entry 1dsp

View 1dsp on RCSB PDB site
Description: cytochrome c peroxidase h175g mutant, imidazole complex at ph 7, room temperature.
Class: oxidoreductase
Keywords: heme enzyme, peroxidase, cavity mutant, ligand binding, oxidoreductase
Deposited on 2000-01-07, released 2001-03-07
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: 0.206
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c peroxidase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00431 (Start-291)
      • conflict (50)
      • conflict (73)
      • conflict (149)
      • engineered (172)
    Domains in SCOPe 2.05: d1dspa_
  • Heterogens: HEM, IMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dspA (A:)
    tlvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdn
    tggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgp
    kipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgagalgkthl
    knsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdp
    kylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dspA (A:)
    lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdnt
    ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
    ipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgagalgkthlk
    nsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpk
    ylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl