PDB entry 1dsn

View 1dsn on RCSB PDB site
Description: d60s n-terminal lobe human lactoferrin
Class: iron transport protein
Keywords: iron transport, glycoprotein, metal-binding, iron transport protein
Deposited on 1995-12-13, released 1996-03-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lactoferrin
    Species: Homo sapiens [TaxId:9606]
    Gene: LFN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02788
      • cloning artifact (27)
      • engineered (59)
    Domains in SCOPe 2.07: d1dsna_
  • Heterogens: FE, CO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dsnA (A:)
    rrrrsvqwcavsqpeatkcfqwqrnmrrvrgppvscikrdspiqciqaiaenradavtls
    ggfiyeaglapyklrpvaaevygterqprthyyavavvkkggsfqlnelqglkschtglr
    rtagwnvpigtlrpflnwtgppepieaavarffsascvpgadkgqfpnlcrlcagtgenk
    cafssqepyfsysgafkclrdgagdvafirestvfedlsdeaerdeyellcpdntrkpvd
    kfkdchlarvpshavvarsvngkedaiwnllrqaqekfgkdkspkfqlfgspsgqkdllf
    kdsaigfsrvppridsglylgsgyftaiqnlrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dsnA (A:)
    rrrsvqwcavsqpeatkcfqwqrnmrrvrgppvscikrdspiqciqaiaenradavtlsg
    gfiyeaglapyklrpvaaevygterqprthyyavavvkkggsfqlnelqglkschtglrr
    tagwnvpigtlrpflnwtgppepieaavarffsascvpgadkgqfpnlcrlcagtgenkc
    afssqepyfsysgafkclrdgagdvafirestvfedlsdeaerdeyellcpdntrkpvdk
    fkdchlarvpshavvarsvngkedaiwnllrqaqekfgkdkspkfqlfgspsgqkdllfk
    dsaigfsrvpprids