PDB entry 1dsl

View 1dsl on RCSB PDB site
Description: gamma b crystallin c-terminal domain
Class: eye lens protein
Keywords: eye lens protein, multigene family
Deposited on 1996-02-01, released 1996-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.21
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gamma b crystallin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dsla_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dslA (A:)
    tfrmriyerddfrgqmseitddcpslqdrfhltevhslnvlegswvlyempsyrgrqyll
    rpgeyrryldwgamnakvgslrrvmdfy