PDB entry 1dsf
View 1dsf on RCSB PDB site
Description: the crystal structure of the disulfide-stabilized fv fragment of anticancer antibody b1: conformational influence of an engineered disulfide bond
Class: immunoglobulin
Keywords: monoclonal antibody, antitumor, immunoglobulin
Deposited on
1997-05-04, released
1998-05-13
The last revision prior to the SCOPe 2.03 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.182
AEROSPACI score: 0.44
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'H':
Compound: anticancer antibody b1
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d1dsfh_ - Chain 'L':
Compound: anticancer antibody b1
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
- PIR B41940 (0-111)
- conflict (26)
- conflict (32)
- conflict (34)
- conflict (40)
- conflict (49)
- conflict (76)
- conflict (104)
Domains in SCOPe 2.03: d1dsfl_ - Heterogens: HOH
PDB Chain Sequences:
- Chain 'H':
Sequence; same for both SEQRES and ATOM records: (download)
>1dsfH (H:)
qlvesggglvkpggslklscaasgfifsdnymywvrqtpekclewvatisdggtyidysd
svkgrftisrdnaknnlylqmsslrsedtgmyycgrspiyydyapftywgqgtlvtvsa
- Chain 'L':
Sequence; same for both SEQRES and ATOM records: (download)
>1dsfL (L:)
dvvmtqtplslpvslgdqasiscrssqnlvhsdgktylhwflqkpgqsptlliykvsnrf
sgvpdrfsgsgsgtdfilkisrveaedlgvyfcsqsthvpltfgcgtklelk