PDB entry 1dsf

View 1dsf on RCSB PDB site
Description: the crystal structure of the disulfide-stabilized fv fragment of anticancer antibody b1: conformational influence of an engineered disulfide bond
Deposited on 1997-05-04, released 1998-05-13
The last revision prior to the SCOP 1.57 freeze date was dated 1998-05-13, with a file datestamp of 1998-05-13.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.182
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Domains in SCOP 1.57: d1dsfh_
  • Chain 'L':
    Domains in SCOP 1.57: d1dsfl_

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1dsfH (H:)
qlvesggglvkpggslklscaasgfifsdnymywvrqtpekclewvatisdggtyidysd
svkgrftisrdnaknnlylqmsslrsedtgmyycgrspiyydyapftywgqgtlvtvsa

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1dsfL (L:)
dvvmtqtplslpvslgdqasiscrssqnlvhsdgktylhwflqkpgqsptlliykvsnrf
sgvpdrfsgsgsgtdfilkisrveaedlgvyfcsqsthvpltfgcgtklelk