PDB entry 1dsf

View 1dsf on RCSB PDB site
Description: the crystal structure of the disulfide-stabilized fv fragment of anticancer antibody b1: conformational influence of an engineered disulfide bond
Class: immunoglobulin
Keywords: monoclonal antibody, antitumor, immunoglobulin
Deposited on 1997-05-04, released 1998-05-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.182
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: anticancer antibody b1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1DSF (0-118)
    Domains in SCOPe 2.08: d1dsfh_
  • Chain 'L':
    Compound: anticancer antibody b1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PIR B41940 (0-111)
      • conflict (26)
      • conflict (32)
      • conflict (34)
      • conflict (40)
      • conflict (49)
      • conflict (76)
      • conflict (104)
    Domains in SCOPe 2.08: d1dsfl_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dsfH (H:)
    qlvesggglvkpggslklscaasgfifsdnymywvrqtpekclewvatisdggtyidysd
    svkgrftisrdnaknnlylqmsslrsedtgmyycgrspiyydyapftywgqgtlvtvsa
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dsfL (L:)
    dvvmtqtplslpvslgdqasiscrssqnlvhsdgktylhwflqkpgqsptlliykvsnrf
    sgvpdrfsgsgsgtdfilkisrveaedlgvyfcsqsthvpltfgcgtklelk