PDB entry 1dse

View 1dse on RCSB PDB site
Description: cytochrome c peroxidase h175g mutant, imidazole complex, with phosphate bound, ph 6, 100k
Class: oxidoreductase
Keywords: heme enzyme, peroxidase, cavity mutant, ligand binding, OXIDOREDUCTASE
Deposited on 2000-01-07, released 2001-03-07
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.198
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c peroxidase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00431 (0-291)
      • conflict (0)
      • conflict (50)
      • conflict (73)
      • conflict (149)
      • engineered (172)
    Domains in SCOPe 2.05: d1dsea_
  • Heterogens: PO4, HEM, IMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dseA (A:)
    tlvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdn
    tggsyggtyrfkkqfndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgp
    kipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgagalgkthl
    knsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdp
    kylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl