PDB entry 1ds7

View 1ds7 on RCSB PDB site
Description: a minor fmn-dependent nitroreductase from escherichia coli b
Class: oxidoreductase
Keywords: nad(p)h-quinone reductase, fmn, nitroreductase, flavoprotein, oxidoreductase
Deposited on 2000-01-07, released 2000-07-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fmn-dependent nitroreductase
    Species: Escherichia coli [TaxId:37762]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ds7a_
  • Chain 'B':
    Compound: fmn-dependent nitroreductase
    Species: Escherichia coli [TaxId:37762]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ds7b_
  • Heterogens: FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ds7A (A:)
    mdiisvalkrhstkafdaskkltpeqaeqiktllqyspsstnsqpwhfivasteegkarv
    aksaagnyvfnerkmldashvvvfcaktamddvwlklvvdqedadgrfatpeakaandkg
    rkffadmhrkdlhddaewmakqvylnvgnfllgvaalgldavpiegfdaaildaefglke
    kgytslvvvpvghhsvedfnatlpksrlpqnitltev
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ds7B (B:)
    mdiisvalkrhstkafdaskkltpeqaeqiktllqyspsstnsqpwhfivasteegkarv
    aksaagnyvfnerkmldashvvvfcaktamddvwlklvvdqedadgrfatpeakaandkg
    rkffadmhrkdlhddaewmakqvylnvgnfllgvaalgldavpiegfdaaildaefglke
    kgytslvvvpvghhsvedfnatlpksrlpqnitltev