PDB entry 1ds6

View 1ds6 on RCSB PDB site
Description: crystal structure of a rac-rhogdi complex
Deposited on 2000-01-07, released 2000-07-12
The last revision prior to the SCOP 1.67 freeze date was dated 2000-07-19, with a file datestamp of 2000-07-19.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.234
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1ds6a_
  • Chain 'B':
    Domains in SCOP 1.67: d1ds6b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ds6A (A:)
    mqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdskpvnlglwdtag
    qedydrlrplsypqtdvflicfslvspasyenvrakwfpevrhhcpstpiilvgtkldlr
    ddkdtieklkekklapitypqglalakeidsvkylecsaltqrglktvfdeairavlcpq
    ptrqqkracsll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ds6A (A:)
    mqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdskpvnlglwdtag
    qedydrlrplsypqtdvflicfslvspasyenvrakwfpevrhhcpstpiilvgtkldlr
    ddkdtieklkekklapitypqglalakeidsvkylecsaltqrglktvfdeairavlcpq
    p
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ds6B (B:)
    gnykpppqkslkelqemdkddeslikykktllgdgpvvtdpkapnvvvtrltlvcesapg
    pitmdltgdlealkketivlkegseyrvkihfkvnrdivsglkyvqhtyrtgvkvdkatf
    mvgsygprpeeyefltpveeapkgmlargtyhnksfftdddkqdhlswewnlsikkewge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ds6B (B:)
    gnykpppqkslkelqemdkddeslikykktllgdgpvvtdpkapnvvvtrltlvcesapg
    pitmdltgdlealkketivlkegseyrvkihfkvnrdivsglkyvqhtyrtgvkvdkatf
    mvgsygprpeeyefltpveeapkgmlargtyhnksfftdddkqdhlswewnlsikkewg