PDB entry 1ds3

View 1ds3 on RCSB PDB site
Description: crystal structure of omtky3-ch2-asp19i
Class: hydrolase inhibitor
Keywords: canonical protein inhibitor, ovomucoid, reduced peptide bond, OMTKY3
Deposited on 2000-01-06, released 2001-01-31
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'I':
    Compound: Ovomucoid
    Species: Meleagris gallopavo
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68390 (0-50)
      • engineered (12-13)
    Domains in SCOP 1.73: d1ds3i_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ds3I (I:)
    vdcseypkpactldyrplcgsdnktygnkcnfcnavvesngtltlshfgkc