PDB entry 1drz
View 1drz on RCSB PDB site
Description: u1a spliceosomal protein/hepatitis delta virus genomic ribozyme complex
Class: RNA binding protein/RNA
Keywords: catalytic RNA, ribozyme, RNA-binding protein, u1a, hdv, RNA binding protein/RNA complex
Deposited on
1998-09-01, released
1999-02-16
The last revision prior to the SCOPe 2.08 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.281
AEROSPACI score: 0.29
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: protein (u1 small ribonucleoprotein a)
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Uniprot P09012 (Start-96)
- engineered (29)
- engineered (34)
Domains in SCOPe 2.08: d1drza_ - Chain 'B':
Compound: RNA (hepatitis delta virus genomic ribozyme)
Species: Hepatitis delta virus [TaxId:12475]
- Heterogens: MG, SO4, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>1drzA (A:)
avpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifke
vssatnalrsmqgfpfydkpmriqyaktdsdiiakmk
Sequence, based on observed residues (ATOM records): (download)
>1drzA (A:)
petrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevs
satnalrsmqgfpfydkpmriqyaktdsdiiakmk
- Chain 'B':
No sequence available.