PDB entry 1drz

View 1drz on RCSB PDB site
Description: u1a spliceosomal protein/hepatitis delta virus genomic ribozyme complex
Class: RNA binding protein/RNA
Keywords: catalytic RNA, ribozyme, RNA-binding protein, u1a, hdv, RNA binding protein/RNA complex
Deposited on 1998-09-01, released 1999-02-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.281
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (u1 small ribonucleoprotein a)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09012 (Start-96)
      • engineered (29)
      • engineered (34)
    Domains in SCOPe 2.08: d1drza_
  • Chain 'B':
    Compound: RNA (hepatitis delta virus genomic ribozyme)
    Species: Hepatitis delta virus [TaxId:12475]
  • Heterogens: MG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1drzA (A:)
avpetrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifke
vssatnalrsmqgfpfydkpmriqyaktdsdiiakmk

    Sequence, based on observed residues (ATOM records): (download) 
    >1drzA (A:)
petrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevs
satnalrsmqgfpfydkpmriqyaktdsdiiakmk

  • Chain 'B':
    No sequence available.