PDB entry 1dru

View 1dru on RCSB PDB site
Description: escherichia coli dhpr/nadh complex
Deposited on 1996-06-28, released 1997-01-27
The last revision prior to the SCOP 1.55 freeze date was dated 1997-01-27, with a file datestamp of 1997-01-27.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.192
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dru_ (-)
    anirvaiagaggrmgrqliqaalalegvqlgaaleregssllgsdagelagagktgvtvq
    ssldavkddfdvfidftrpegtlnhlafcrqhgkgmvigttgfdeagkqairdaaadiai
    vfaanfsvgvnvmlkllekaakvmgdytdieiieahhrhkvdapsgtalamgeaiahald
    kdlkdcavysreghtgervpgtigfatvragdivgehtamfadigerleithkassrmtf
    angavrsalwlsgkesglfdmrdvldlnnl