PDB entry 1drt

View 1drt on RCSB PDB site
Description: crystal structure of clavaminate synthase in complex with fe(II), 2-oxoglutarate and proclavaminic acid
Class: oxidoreductase,lyase
Keywords: Oxygenase, Trifunctional Enzyme, CLAVAMINATE SYNTHASE 1, OXIDOREDUCTASE,LYASE
Deposited on 2000-01-06, released 2000-07-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.219
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: clavaminate synthase 1
    Species: Streptomyces clavuligerus [TaxId:1901]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1drta_
  • Heterogens: PCV, FE2, AKG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1drtA (A:)
    mtsvdctaygpelralaarlprtpradlyafldaahtaaaslpgalataldtfnaegsed
    ghlllrglpveadadlpttpsstpapedrslltmeamlglvgrrlglhtgyrelrsgtvy
    hdvypspgahhlssetsetllefhtemayhrlqpnyvmlacsradhertaatlvasvrka
    lplldertrarlldrrmpccvdvafrggvddpgaiaqvkplygdaddpflgydrellape
    dpadkeavaalskaldevteavylepgdllivdnfrtthartpfsprwdgkdrwlhrvyi
    rtdrngqlsggeragdvvaftprg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1drtA (A:)
    tsvdctaygpelralaarlprtpradlyafldaahtaaaslpgalataldtfnaegsedg
    hlllrglpveadadlpttpsstpapedrslltmeamlglvgrrlglhtgyrelrsgtvyh
    dvypspgahhlssetsetllefhtemayhrlqpnyvmlacsradhertaatlvasvrkal
    plldertrarlldrrmpccvdvafriaqvkplygdaddpflgydrellapedpadkeava
    alskaldevteavylepgdllivdnfrtthartpfsprwdgkdrwlhrvyirtdrngqls
    ggeragdvvaftprg