PDB entry 1dro

View 1dro on RCSB PDB site
Description: nmr structure of the cytoskeleton/signal transduction protein
Deposited on 1995-09-29, released 1996-04-03
The last revision prior to the SCOP 1.61 freeze date was dated 1996-04-03, with a file datestamp of 1996-04-03.
Experiment type: NMR15
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.61: d1dro__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dro_ (-)
    gsgtgageghegyvtrkhewdsttkkasnrswdkvymaakagrisfykdqkgyksnpelt
    frgepsydlqnaaieiasdytkkkhvlrvklangalfllqahddtemsqwvtslkaqsds
    ta