PDB entry 1dro

View 1dro on RCSB PDB site
Description: nmr structure of the cytoskeleton/signal transduction protein
Class: cytoskeleton
Keywords: cytoskeleton
Deposited on 1995-09-29, released 1996-04-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-spectrin
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00963 (0-121)
      • engineered (1-3)
    Domains in SCOPe 2.07: d1droa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1droA (A:)
    gsgtgageghegyvtrkhewdsttkkasnrswdkvymaakagrisfykdqkgyksnpelt
    frgepsydlqnaaieiasdytkkkhvlrvklangalfllqahddtemsqwvtslkaqsds
    ta