PDB entry 1drm

View 1drm on RCSB PDB site
Description: crystal structure of the ligand free bjfixl heme domain
Class: transferase
Keywords: FixL, heme domain, crystal structure, PAS family, two-component system, histidine kinase, TRANSFERASE
Deposited on 2000-01-06, released 2000-01-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.199
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sensor protein fixl
    Species: BRADYRHIZOBIUM JAPONICUM [TaxId:375]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1drma_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1drmA (A:)
    mrethlrsilhtipdamividghgiiqlfstaaerlfgwseleaigqnvnilmpepdrsr
    hdsyisryrttsdphiigigrivtgkrrdgttfpmhlsigemqsggepyftgfvrdlteh
    qqtqarlqelq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1drmA (A:)
    ipdamividghgiiqlfstaaerlfgwseleaigqnvnilmpepdrsrhdsyisryrtts
    dphiigigrivtgkrrdgttfpmhlsigemqsggepyftgfvrdltehqqtqarlqelq