PDB entry 1drj

View 1drj on RCSB PDB site
Description: probing protein-protein interactions: the ribose-binding protein in bacterial transport and chemotaxis
Class: sugar transport
Keywords: sugar transport
Deposited on 1994-09-23, released 1995-01-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: d-ribose-binding protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02925 (0-270)
      • conflict (133)
    Domains in SCOPe 2.07: d1drja_
  • Heterogens: RIP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1drjA (A:)
    kdtialvvstlnnpffvslkdgaqkeadklgynlvvldsqnnpakelanvqdltvrgtki
    llinptdsdavgnavkmanqanipvitldrqatkgevvshiasdnvlggkiagdyiakka
    gegakvielqgiartsaarergegfqqavaahkfnvlasqpadfdrikglnvmqnlltah
    pdvqavfaqndemalgalralqtagksdvmvvgfdgtpdgekavndgklaatiaqlpdqi
    gakgvetadkvlkgekvqakypvdlklvvkq