PDB entry 1drh

View 1drh on RCSB PDB site
Description: isomorphous crystal structures of escherichia coli dihydrofolate reductase complexed with folate, 5-deazafolate and 5,10-dideazatetrahydrofolate: mechanistic implications
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 1994-11-30, released 1995-02-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.208
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: dihydrofolate reductase
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0ABQ4 (0-158)
    • conflict (36)
  Domains in SCOPe 2.08: d1drha_
• Heterogens: NAP, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1drhA (A:)
  misliaalavdrvigmenampwnlpadlawfkrntldkpvimgrhtwesigrplpgrkni
  ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
  gdthfpdyepddwesvfsefhdadaqnshsycfeilerr