PDB entry 1drg

View 1drg on RCSB PDB site
Description: crystal structure of trimeric cre recombinase-lox complex
Class: hydrolase, ligase/DNA
Keywords: site-specific recombinase, recombination, protein-DNA complex, trimeric, three- way junction, branched DNA, hydrolase, ligase-DNA complex
Deposited on 2000-01-06, released 2001-10-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.186
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cre recombinase
    Species: Enterobacteria phage P1 [TaxId:10678]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06956 (0-322)
      • engineered (303)
    Domains in SCOPe 2.07: d1drga1, d1drga2
  • Chain 'B':
    Compound: 5'-d(*tp*ap*tp*ap*ap*cp*tp*tp*cp*gp*tp*ap*tp*ap*gp*c)-3'
  • Chain 'C':
    Compound: 5'-d(*ap*tp*ap*tp*gp*cp*tp*ap*tp*ap*cp*gp*ap*ap*gp*tp*tp*ap*t)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1drgA (A:)
    devrknlmdmfrdrqafsehtwkmllsvcrswaawcklnnrkwfpaepedvrdyllylqa
    rglavktiqqhlgqlnmlhrrsglprpsdsnavslvmrrirkenvdagerakqalafert
    dfdqvrslmensdrcqdirnlaflgiayntllriaeiarirvkdisrtdggrmlihigrt
    ktlvstagvekalslgvtklverwisvsgvaddpnnylfcrvrkngvaapsatsqlstra
    legifeathrliygakddsgqrylawsghsarvgaardmaragvsipeimqaggwtnvni
    vmnfirnldsetgamvrlledgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1drgA (A:)
    devrknlmdmfrdrqafsehtwkmllsvcrswaawcklnnrkwfpaepedvrdyllylqa
    rglavktiqqhlgqlnmlhrrsglprpsdsnavslvmrrirkenvdagerakqalafert
    dfdqvrslmensdrcqdirnlaflgiayntllriaeiarirvkdisrtdggrmlihigve
    kalslgvtklverwisvsgvaddpnnylfcrvrkngvaapsatsqlstralegifeathr
    liygakddsgqrylawsghsarvgaardmaragvsipeimqaggwtnvnivmnfirnlds
    etgamvrlledgd
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.