PDB entry 1dre

View 1dre on RCSB PDB site
Description: dihydrofolate reductase complexed with methotrexate and nicotinamide adenine dinucleotide phosphate (oxidized form)
Class: oxidoreductase
Keywords: oxidoreductase, nadp, trimethoprim resistance, methotrexate resistance, one-carbon metabolism
Deposited on 1996-11-28, released 1997-03-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.216
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrofolate reductase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABQ4 (0-158)
      • conflict (36)
    Domains in SCOPe 2.07: d1drea_
  • Heterogens: MTX, NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dreA (A:)
    misliaalavdrvigmenampwnlpadlawfkrntldkpvimgrhtwesigrplpgrkni
    ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
    gdthfpdyepddwesvfsefhdadaqnshsycfeilerr