PDB entry 1drb

View 1drb on RCSB PDB site
Description: crystal structure of unliganded escherichia coli dihydrofolate reductase. ligand-induced conformational changes and cooperativity in binding
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 1991-11-06, released 1994-01-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrofolate reductase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABQ4 (0-158)
      • conflict (26)
      • conflict (36)
    Domains in SCOPe 2.08: d1drba_
  • Chain 'B':
    Compound: dihydrofolate reductase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABQ4 (0-158)
      • conflict (26)
      • conflict (36)
    Domains in SCOPe 2.08: d1drbb_
  • Heterogens: CL, MTX, EOH, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1drbA (A:)
    misliaalavdrvigmenampwnlpaclawfkrntldkpvimgrhtwesigrplpgrkni
    ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
    gdthfpdyepddwesvfsefhdadaqnshsycfeilerr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1drbB (B:)
    misliaalavdrvigmenampwnlpaclawfkrntldkpvimgrhtwesigrplpgrkni
    ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
    gdthfpdyepddwesvfsefhdadaqnshsycfeilerr