PDB entry 1dr9

View 1dr9 on RCSB PDB site
Description: crystal structure of a soluble form of b7-1 (cd80)
Class: immune system
Keywords: ig superfamily, immune system
Deposited on 2000-01-06, released 2000-01-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.238
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: t lymphocyte activation antigen
    Species: Homo sapiens [TaxId:9606]
    Gene: CHO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P33681 (0-End)
      • engineered (199)
    Domains in SCOPe 2.07: d1dr9a1, d1dr9a2
  • Heterogens: NAG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dr9A (A:)
    vihvtkevkevatlscghnvsveelaqtriywqkekkmvltmmsgdmniwpeyknrtifd
    itnnlsivilalrpsdegtyecvvlkyekdafkrehlaevtlsvkadfptpsisdfeipt
    snirriicstsggfpephlswlengeelnainttvsqdpetelyavsskldfnmttnhsf
    mclikyghlrvnqtfnwntak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dr9A (A:)
    vihvtkevkevatlscghnvsveelaqtriywqkekkmvltmmsgdmniwpeyknrtifd
    itnnlsivilalrpsdegtyecvvlkyekdafkrehlaevtlsvkadfptpsisdfeipt
    snirriicstsggfpephlswlengeelnainttvsqdpetelyavsskldfnmttnhsf
    mclikyghlrvnqtfnwnta