PDB entry 1dr6

View 1dr6 on RCSB PDB site
Description: crystal structures of organomercurial-activated chicken liver dihydrofolate reductase complexes
Deposited on 1992-03-14, released 1993-10-31
The last revision prior to the SCOP 1.57 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.4 Å
R-factor: 0.141
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1dr6__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dr6_ (-)
    vrslnsivavcqnmgigkdgnlpwpplrneykyfqrmtstshvegkqnavimgkktwfsi
    peknrplkdrinivlsrelkeapkgahylskslddalalldspelkskvdmvwivggtav
    ykaamekpinhrlfvtrilhefesdtffpeidykdfkllteypgvpadiqeedgiqykfe
    vyqksv